Blast Summary:PSI-Blast Search Many matches in gapped BLAST to 50S ribosomal protein L9; e.g. residues 1-150 are 61% similar to 50S ribosomal protein L9 of Streptococcus pyogenes (15675918); residues 1-149 are 37% similar to 50S ribosomal protein L9 of Bacillus subtilis (16081102).
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG2140 (1e-43).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 12 clades of COG0359
COG name: Ribosomal protein L9
Functional Class: J
The phylogenetic pattern of COG0359 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search ***** IPB000244 (Ribosomal protein L9) with a combined E-value of 1.1e-31. IPB000244A 1-31 IPB000244B 86-100 IPB000244C 123-147
ProDom Summary:Protein Domain Search Residues 1-104 are 37% similar to a (RIBOSOMAL 50S RRNA-BINDING PROTEOME) protein domain (PD003590 which is seen in Q9CHI6_LACLA.
Residues 84-148 are 38% similar to a (RIBOSOMAL 50S L9 RRNA-BINDING) protein domain (PD287380 which is seen in RL9_THEMA.
Paralogs:Local Blast Search SMu1941 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 1 to 52 (E-value = 3.1e-22) place SMu1941 in the Ribosomal_L9_N family which is described as Ribosomal protein L9, N-terminal domain (PF01281) Residues 62 to 150 (E-value = 6.9e-20) place SMu1941 in the Ribosomal_L9_C family which is described as Ribosomal protein L9, C-terminal domain (PF03948)
Top PDB Hits: pdb|487D|K Chain K, Seven Ribosomal Proteins Fitted To A Cryo-E... 92 3e-020
Gene Protein Sequence:
MKVIFLADVKGKGKRGEVKEVSTGYAQNFLIKKNLAKEATKQAINELKGK QKSEEKAQAELLAEAKAVKVKLEQESTLVQFSEKVGPDGRTFGSITSKKI SEELNKQFGIKLDKRYIKLDHPIRTIGLIEIPVKLHKDIDGIIKLQIKEA