Basic Search | Intermediate Search | Gene Image Map |  Home

Streptococcus mutans Search Results

Record: 1 of 1  
MiniMap IGR1581 IGR1580 IGR1575 IGR1583 IGR1579 IGR1576 IGR1584 IGR1578 IGR1582 IGR1572 IGR1577 IGR1587 IGR1585 IGR1574 IGR1573 IGR1586 rps10,rpsJ, - SMu1841 rps19,rpsS, - SMu1838 rs14,rpsN, - SMu1829 rl29,rpmC, - SMu1834 rs17,rpsQ, - SMu1833 rl24,rplX, - SMu1831 rl22,rplV, - SMu1837 rl14,rplN, - SMu1832 rs8,rpsH, - SMu1828 rl16,rplP, - SMu1835 rl6,rplF, - SMu1827 rl5,rplE, - SMu1830 rs3,rpsC, - SMu1836 rl3,rplC, - SMu1840 sacB,ftf, - SMu1843 SMu1842 rps10,rpsJ, - SMu1841 rps19,rpsS, - SMu1838 rs14,rpsN, - SMu1829 rl29,rpmC, - SMu1834 rs17,rpsQ, - SMu1833 rl24,rplX, - SMu1831 rl22,rplV, - SMu1837 rl14,rplN, - SMu1832 rs8,rpsH, - SMu1828 rl16,rplP, - SMu1835 rl6,rplF, - SMu1827 rl5,rplE, - SMu1830 rs3,rpsC, - SMu1836 rl3,rplC, - SMu1840 sacB,ftf, - SMu1843 SMu1842 Type: tandem, Name: SMu-TR-33 - 33 rps10,rpsJ, - SMu1841 rs14,rpsN, - SMu1829 rl24,rplX, - SMu1831 rl22,rplV, - SMu1837 rl14,rplN, - SMu1832 rs8,rpsH, - SMu1828 rl16,rplP, - SMu1835 rl6,rplF, - SMu1827 rl5,rplE, - SMu1830 rs3,rpsC, - SMu1836 rl3,rplC, - SMu1840 sacB,ftf, - SMu1843 rl4,rplD, - SMu1839 rps19,rpsS, - SMu1838 rs17,rpsQ, - SMu1833 rl4,rplD, - SMu1839 rl29,rpmC, - SMu1834 SMu1842


LANL Gene ID: SMu1837

GenBank Locus Tag: SMU.2022c

DNA Molecule Name:
1  

GenBank ID:


Gene Name:
rl22  rplV  

Definition:
50S ribosomal protein L22

Cellular Location:
Cytoplasm [Evidence]

Gene Start:
1891910

Gene Stop:
1891566

Gene Length:
345

Molecular Weight*:
12428

pI*:
11.50

Net Charge*:
11.23

EC:
 

Functional Class:
Protein synthesis; Ribosomal proteins: synthesis and modification  

Gene Ontology:
Biological process
  GO:0006412    translation

Cellular component
  GO:0005622    intracellular
  GO:0005840    ribosome
  GO:0015934    large ribosomal subunit

Molecular function
  GO:0003735    structural constituent of ribosome


Pathway: pathway table

Secondary Evidence:
Kromer,W.J., Hatakeyama,T. and Kimura,M.
Nucleotide sequences of Bacillus stearothermophilus ribosomal protein genes: part of the ribosomal S10 operon.
Biol. Chem. Hoppe-Seyler 371 (7): 631-636 (1990)
PubMed: 2222862.

Comment:
For other 'rl' genes see SMu1819.1 (rl36);SMu1909.1(rl32);SMu0108 (rl28);SMu1840 (rl3);SMu1839 (rl4); SMu1835 (rl16); SMu1834 (rl29); SMu1832 (rl14); SMu1831 (rl24); SMu1830 (rl5); SMu1827 (rl6); SMu1826 (rl18); SMu1824 (rl30); SMu1823 (rl15); SMu1816 (rl17) and SMu1941 (rl9).

From GenBank (gi7674235): In S.pneumoniae, this protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins; e.g. L4, L17, and L20. It is important during the early stages of 50S reconstitution and belongs to the L22P family of ribosomal proteins.



View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
Many moderate matches in gapped BLAST to 50S ribosomal protein L22; residues 1-114 are 95% similar to 50S ribosomal protein L22 of Streptococcus pyogenes (gi15674292); residues 1-114 are 87% similar to 50S ribosomal protein L22 of Streptococcus pneumoniae (gi7674235).

See Spy0055.




The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0063 (3e-58).


Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|24380364|ref|NP_722319.1|  50S ribosomal protein L22 [Str...   171   9e-42
 gi|55821900|ref|YP_140342.1|  50S ribosomal protein L22 [Str...   169   3e-41
 gi|22536248|ref|NP_687099.1|  50S ribosomal protein L22 [Str...   169   5e-41
 gi|15674292|ref|NP_268465.1|  50S ribosomal protein L22 [Str...   166   3e-40
 gi|50913444|ref|YP_059416.1|  50S ribosomal protein L22 [Str...   166   4e-40
 gi|157075477|gb|ABV10160.1|  ribosomal protein L22 [Streptoc...   162   7e-39
 gi|125716990|ref|YP_001034123.1|  50S ribosomal protein L22,...   162   7e-39
 gi|146317736|ref|YP_001197448.1|  Ribosomal protein L22 [Str...   155   5e-37
 gi|15900150|ref|NP_344754.1|  50S ribosomal protein L22 [Str...   153   2e-36
 gi|15674076|ref|NP_268251.1|  50S ribosomal protein L22 [Lac...   151   1e-35


InterPro Summary:  InterProScan

InterPro
IPR001063
Family
Ribosomal protein L22/L17
PD001032 [35-113]T 0.0 PD001032 Ribosomal_L22 Ribosomal_L22
G3DSA:3.90.470.10 [5-113]T 1.2000011745813999E-37 G3DSA:3.90.470.10 Ribosomal_L22 Ribosomal_L22
PF00237 [9-113]T 7.30000590915171E-57 PF00237 Ribosomal_L22 Ribosomal_L22
PS00464 [87-111]T 8.0E-5 PS00464 RIBOSOMAL_L22 RIBOSOMAL_L22
SSF54843 [5-114]T 6.100000000000001E-43 SSF54843 Ribosomal_L22 Ribosomal_L22
InterPro
IPR005727
Family
Ribosomal protein L22, bacterial and organelle form
PTHR13501 [9-113]T 4.30000170645879E-17 PTHR13501 Ribosom_L22_bac Ribosom_L22_bac
TIGR01044 [9-111]T 4.57417811979533E-61 TIGR01044 rplV_bact rplV_bact


COGS Summary:  COGS Search
BeTs to 17 clades of COG0091
COG name: Ribosomal protein L22
Functional Class: J
The phylogenetic pattern of COG0091 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1
Blocks Summary:  Blocks Search
***** IPB001063 (Ribosomal protein L22p / L17e) with a combined E-value of 1.7e-60.
    IPB001063A    9-39
    IPB001063B    40-65
    IPB001063C    68-111


 ProDom Summary:  Protein Domain Search
Residues 8-111 are 87% similar to a (RIBOSOMAL 50S RRNA-BINDING CHLOROPLAST COMPLETE 60S) protein domain (PD001032 which is seen in RL22_STRPN.


Paralogs:  Local Blast Search
SMu1837 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 113 (E-value = 6.5e-60) place SMu1837 in the Ribosomal_L22 family which is described as Ribosomal protein L22p/L17e (PF00237)

 Top PDB Hits:
pdb1BXEA Chain A, Ribosomal Protein L22 From Thermus Thermoph... 109 1e-025

Gene Protein Sequence:
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARI
VEKTLNSAVANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPI
NKRTTHVTVVVEEK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGAAATTACTTCAGCTAAAGCAATGGCTCGTACAGTCCGTGTTTC
ACCTCGTAAAACACGTCTTGTGCTTGATCTTATTCGTGGTAAGAACGTTG
CTGACGCAATCGCAATCTTGAAATTCACTCCAAACAAAGCTGCTCGTATT
GTTGAGAAAACTCTTAACTCTGCTGTCGCAAATGCAGAAAATAACTTTGG
TTTGGAAAAAGCTAATTTGGTCGTATCTGAAACTTTCGCAAACGAAGGAC
CAACGATGAAACGTTTCCGTCCGCGTGCGAAGGGTTCGGCTTCACCAATC
AATAAACGTACAACTCACGTTACTGTAGTTGTAGAAGAAAAATAA

Los Alamos National Laboratory • Est 1943

Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy