Blast Summary:PSI-Blast Search Few moderate matches in gapped BLAST to competence-specific global transcription modulator; residues 1-160 are 43% similar to competence protein of Streptococcus pyogenes (gi15674470); residues 8-157 are 46% similar to transcriptional regulator ComX1 of Streptococcus pneumoniae (gi15899963).
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0091 (1e-39).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search No hits to the COGs database. Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 18-144 are 48% similar to a (PROTEOME COMPLETE REGULATOR COMPETENCE) protein domain (PD303084 which is seen in Q9R2W8_STRPN.
Paralogs:Local Blast Search SMu1814 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search No significant hits to the Pfam 11.0 database
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MEEDFEIVFNKVKPIVWKLSRYYFIKMWTREDWQQEGMLILHQLLREHPE LEEDDTKLYIYFKTRFSNYIKDVLRQQESQKRRFNRMSYEEVGEIEHCLS SGGMQLDEYILFRDSLLAYKQGLSTEKQELFERLVAGEHFLGRQSMLKDL RKKLSDFKEK