Basic Search | Intermediate Search | Gene Image Map |  Home

Streptococcus mutans Search Results

Record: 1 of 1  
MiniMap IGR633 IGR637 IGR638 IGR635 IGR632 IGR634 SMu0731 ykhF, - SMu0729 glnP, - SMu0732 SMu0728 SMu0733 SMu0730 obg, - SMu0727 uvrB, - SMu0734 SMu0731 ykhF, - SMu0729 glnP, - SMu0732 SMu0728 SMu0733 SMu0730 obg, - SMu0727 uvrB, - SMu0734 SMu0731 ykhF, - SMu0729 glnP, - SMu0732 SMu0728 SMu0733 SMu0730 obg, - SMu0727 uvrB, - SMu0734


LANL Gene ID: SMu0731

GenBank Locus Tag: SMU.805c

DNA Molecule Name:
1  

GenBank ID:
24379262

Gene Name:


Definition:
amino acid ABC transporter, ATP-binding protein

Cellular Location:
Cytoplasm, Membrane [Evidence]

Gene Start:
752001

Gene Stop:
751261

Gene Length:
741

Molecular Weight*:
27165

pI*:
4.80

Net Charge*:
-10.59

EC:
 

Functional Class:
Transport and binding proteins; ABC Superfamily: ATP-binding protein  

Gene Ontology:
Molecular function
  GO:0000166    nucleotide binding
  GO:0005524    ATP binding
  GO:0016887    ATPase activity
  GO:0017111    nucleoside-triphosphatase activity


Pathway: pathway table

Primary Evidence:
Russell,R.R.B., Aduse-Opuko,J., Sutcliffe,I.C., Tao,L. and
Ferretti,J.J.
A binding protein-dependent transport system in Streptococcus
mutans responsible for multiple sugar metabolism
J. Biol. Chem. 267, 4631-4637 (1992)
PubMed: 1537846

Russell RR, Ferretti JJ
Nucleotide sequence of the dextran glucosidase (dexB) gene of Streptococcus mutans.
J Gen Microbiol 1990 May;136 ( Pt 5):803-10
PubMed: 2380687
PMID: 2380687

Aduse-Opoku J, Tao L, Ferretti JJ, Russell RR
Biochemical and genetic analysis of Streptococcus mutans alpha-galactosidase.
J Gen Microbiol 1991 Apr;137 ( Pt 4):757-64
PubMed: 1649890
PMID: 1649890

Ferretti JJ, Huang TT, Russell RR
Sequence analysis of the glucosyltransferase A gene (gtfA) from Streptococcus mutans Ingbritt.
Infect Immun 1988 Jun;56(6):1585-8
PubMed: 2967248
PMID: 2967248


Comment:
For other components see SMu0732 (MSD1) and (SBP1).



View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ABC transporter,ATP-binding proteins : residues 17-224 are 40% similar to the previously published protein in S.mutans (15625431|).

Several matches in gapped BLAST to amino acid ABC transporter, ATP-binding proteins: residues 1-246 are 88% similar to the protein in S.pyogenes (15675264)and are 81% similar to the protein from S.pneumoniae (15903164|).






The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1467 (1e-124).


Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|24379262|ref|NP_721217.1|  putative amino acid ABC transp...   479   e-134
 gi|71903723|ref|YP_280526.1|  glutamine transport ATP-bindin...   438   e-121
 gi|94990642|ref|YP_598742.1|  Glutamine transport ATP-bindin...   437   e-121
 gi|15675264|ref|NP_269438.1|  putative ABC transporter (ATP-...   436   e-121
 gi|94994566|ref|YP_602664.1|  Glutamine transport ATP-bindin...   435   e-120
 gi|50914392|ref|YP_060364.1|  Glutamine transport ATP-bindin...   434   e-120
 gi|22537610|ref|NP_688461.1|  glutamine ABC transporter, ATP...   431   e-119
 gi|55821478|ref|YP_139920.1|  glutamine ABC uptake transport...   414   e-114
 gi|116628199|ref|YP_820818.1|  ABC-type polar amino acid tra...   414   e-114
 gi|81096057|ref|ZP_00874407.1|  Phosphate-transporting ATPas...   409   e-113


InterPro Summary:  InterProScan

InterPro
IPR003439
Domain
ABC transporter related
PD000006 [141-183]T 0.0 PD000006 ABC_transporter ABC_transporter
PF00005 [31-216]T 6.100026561498099E-61 PF00005 ABC_tran ABC_tran
PS00211 [141-155]T 8.0E-5 PS00211 ABC_TRANSPORTER_1 ABC_TRANSPORTER_1
PS50893 [6-240]T 0.0 PS50893 ABC_TRANSPORTER_2 ABC_TRANSPORTER_2
InterPro
IPR003593
Domain
AAA+ ATPase, core
SM00382 [30-216]T 4.99999999999978E-14 SM00382 AAA AAA
noIPR
unintegrated
unintegrated
G3DSA:3.40.50.300 [6-242]T 1.3000049540732398E-80 G3DSA:3.40.50.300 G3DSA:3.40.50.300 G3DSA:3.40.50.300
PTHR19222 [6-245]T 0.0 PTHR19222 PTHR19222 PTHR19222
PTHR19222:SF33 [6-245]T 0.0 PTHR19222:SF33 PTHR19222:SF33 PTHR19222:SF33
SSF52540 [6-243]T 1.1999999999999999E-76 SSF52540 SSF52540 SSF52540


COGS Summary:  COGS Search
BeTs to 8 clades of COG1126
COG name: ABC-type polar amino acid transport system, ATPase component
Functional Class: E
The phylogenetic pattern of COG1126 is a-----vcEB-Huj----inx
Number of proteins in this genome belonging to this COG is 7
Blocks Summary:  Blocks Search
***** IPB001140 (ABC transporter transmembrane region) with a combined E-value of 8.1e-35.
    IPB001140A    20-66
    IPB001140B    138-176
    IPB001140C    192-221


 ProDom Summary:  Protein Domain Search
Residues 186-224 are 89% similar to a (ATP-BINDING TRANSPORT COMPLETE PROTEOME ABC TRANSPORTER) protein domain (PD000079 which is seen in Q9CES4_LACLA.

Residues 184-225 are 76% similar to a (ATP-BINDING COMPLETE PROTEOME TRANSPORT) protein domain (PD007174 which is seen in Q9JVC3_NEIMA.

Residues 124-198 are 38% similar to a (ATP-BINDING TRANSPORTER ABC ABC-TYPE) protein domain (PD027424 which is seen in YN26_MYCTU.

Residues 84-138 are 50% similar to a (ATP-BINDING TRANSPORT COMPLETE PROTEOME TRANSPORTER ABC) protein domain (PD007166 which is seen in Q9RUM8_DEIRA.

Residues 5-243 are 26% similar to a (ATP-BINDING TRANSPORT COMPLETE MJ0121) protein domain (PD039360 which is seen in O27709_METTH.

Residues 125-218 are 32% similar to a (ATP-BINDING PROTEOME COMPLETE 230AA) protein domain (PD169303 which is seen in Q9WW89_LACLC.

Residues 74-115 are 54% similar to a (ATP-BINDING TRANSPORT PROTEOME ABC) protein domain (PD412673 which is seen in O34677_BACSU.

Residues 184-240 are 59% similar to a (ATP-BINDING TRANSPORT COMPLETE PROTEOME) protein domain (PD255463 which is seen in GLNQ_ECOLI.

Residues 141-220 are 37% similar to a (ATP-BINDING) protein domain (PD397028 which is seen in Q53712_STRAT.

Residues 185-224 are 60% similar to a (ATP-BINDING TRANSPORT PROTEOME COMPLETE) protein domain (PD359629 which is seen in Q9KGD1_BACHD.

Residues 82-114 are 69% similar to a (ATP-BINDING TRANSPORT COMPLETE PROTEOME ABC TRANSPORTER) protein domain (PD259496 which is seen in Q9CES4_LACLA.

Residues 123-234 are 25% similar to a (ABC-BINDING PROTEOME RELATED OLIGOPEPTIDE) protein domain (PD077779 which is seen in Q9HIQ1_THEAC.

Residues 21-71 are 72% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000005 which is seen in Q9CES4_LACLA.

Residues 141-183 are 93% similar to a (ATP-BINDING TRANSPORT ABC TRANSPORTER COMPLETE PROTEOME) protein domain (PD000006 which is seen in Q9CES4_LACLA.

Residues 84-139 are 44% similar to a (ATP-BINDING PROTEOME AMINO COMPLETE) protein domain (PD194799 which is seen in Q9PKQ8_CHLMU.


Paralogs:  Local Blast Search
SMu0731 is paralogously related (blast p-value < 1e-3) to SMu0517, SMu0218, SMu1380, SMu0849, SMu0418, SMu1762, SMu1079, SMu1920, SMu1288, SMu1036, SMu1210, SMu1003, SMu0971, SMu0786, SMu1037, SMu0916, SMu0884, SMu1949, SMu1068, SMu1246, SMu1231, SMu1950, SMu0234, SMu1428, SMu0235, SMu1518, SMu0805, SMu0594, SMu1751, SMu1023, SMu1001, SMu1757, SMu0390, SMu1517, SMu0596, SMu0950, SMu0335, SMu0374, SMu0216, SMu0907, SMu1064, SMu1649, SMu0836, SMu0825, SMu0476, SMu1410, SMu0224, SMu0824, SMu1710, SMu0976, SMu1316, SMu0986, SMu0944, SMu0475, SMu0752, SMu1811, SMu0024, SMu0164, SMu0823, SMu0258, SMu1959, SMu1065, SMu0837, SMu1093, SMu0666, SMu1306, SMu0987, SMu0729, SMu1545, SMu1724, SMu1050, SMu1202, and SMu1686 all with ATP-binding capabilities.


Pfam Summary:  Pfam Search
Residues 31 to 216 (E-value = 1.1e-63) place SMu0731 in the ABC_tran family which is described as ABC transporter (PF00005)

 Top PDB Hits:
pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permea... 263 2e-071
pdb|1G29|1 Chain 1, Malk >gi|12084695|pdb|1G29|2 Chain 2, Malk 145 4e-036

Gene Protein Sequence:
MTDLKIDVQDLHKSFGKNEVLKGIDVQFNEGDVVCIIGPSGSGKSTFLRT
LNLLETVTSGKVIVDGYKLSDPSTNVDKARENIGMVFQHFNLFPHMTVLD
NVTFAPIELGRESKEEAQKHGMELLEKVGLSDKAQAYPNSLSGGQKQRVA
IARSLAMNPDIMLFDEPTSALDPEMVGDVLNVMKDLAEQGMTMLIVTHEM
GFARKVANRVIFTDGGQFLEDGSPEEIFDNPQHPRLKDFLDKVLNV

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGACCTAAAAATTGATGTTCAGGATTTACATAAATCCTTTGGTAA
AAATGAAGTCCTCAAAGGGATTGACGTCCAATTTAACGAGGGAGATGTGG
TGTGCATCATCGGTCCTTCAGGATCAGGAAAATCAACTTTTCTTCGGACC
TTGAATCTCCTTGAAACAGTCACTAGCGGCAAGGTCATTGTAGATGGTTA
TAAATTGTCAGATCCATCGACCAATGTTGACAAGGCACGAGAAAATATCG
GTATGGTCTTCCAACACTTTAATCTTTTCCCACATATGACTGTTCTTGAT
AATGTCACTTTTGCTCCTATCGAACTTGGCAGAGAATCCAAGGAAGAAGC
ACAAAAGCATGGCATGGAACTTCTAGAAAAAGTTGGACTTTCGGATAAAG
CCCAAGCCTATCCTAACAGCCTTTCTGGCGGCCAAAAACAACGTGTTGCC
ATTGCACGCAGCTTAGCCATGAACCCAGATATCATGCTTTTCGATGAACC
AACTTCTGCCCTTGACCCTGAAATGGTTGGCGATGTTCTCAACGTTATGA
AAGACCTAGCTGAGCAAGGTATGACTATGCTTATCGTAACACACGAAATG
GGTTTTGCCCGCAAAGTGGCCAACCGTGTGATTTTCACTGATGGCGGTCA
ATTTCTTGAGGATGGCTCACCTGAAGAAATCTTTGATAACCCACAGCACC
CACGTCTCAAAGACTTCCTGGATAAAGTGTTGAATGTCTAA

Los Alamos National Laboratory • Est 1943

Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy