Secondary Evidence: Henkin,T.M., Moon,S.H., Mattheakis,L.C. and Nomura,M. Cloning and analysis of the spc ribosomal protein operon of Bacillus subtilis: comparison with the spc operon of Escherichiacoli. Nucleic Acids Res. 17 (18): 7469-7486 (1989) PubMed: 2508062.
Suh,J.W., Boylan,S.A., Oh,S.H. and Price,C.W. Genetic and transcriptional organization of the Bacillus subtilis spc-alpha region. Gene 169 (1): 17-23 (1996) PubMed: 8635744.
From GenBank (gi:7674183): In Streptococcus pneumoniae, this protein binds directly to 23S ribosomal RNA and belongs to the L14P family of ribosomal proteins.
Blast Summary:PSI-Blast Search Many moderate matches in gapped BLAST to 50S ribosomal protein L14; residues 1-122 are 84% similar to 50S ribosomal protein L14 of Streptococcus pneumoniae (gi7674183); residues 1-122 are 81% similar to 50S ribosomal protein L14 of Streptococcus pyogenes (gi15674297).
See Spy0061.
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0068 (6e-51).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 17 clades of COG0093
COG name: Ribosomal protein L14
Functional Class: J
The phylogenetic pattern of COG0093 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search ***** IPB000218 (Ribosomal protein L14b/L23e family) with a combined E-value of 5.2e-71. IPB000218A 1-26 IPB000218B 32-67 IPB000218C 73-108 IPB000218D 113-122
ProDom Summary:Protein Domain Search Residues 1-122 are 84% similar to a (RIBOSOMAL 50S CHLOROPLAST RRNA-BINDING MITOCHONDRION 60S) protein domain (PD001093 which is seen in RL14_STRPN.
Paralogs:Local Blast Search SMu1832 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 1 to 122 (E-value = 3.5e-76) place SMu1832 in the Ribosomal_L14 family which is described as Ribosomal protein L14p/L23e (PF00238)
Top PDB Hits: pdb487DM Chain M, Seven Ribosomal Proteins Fitted To A Cryo-E... 176 9e-046 pdb1FFKH Chain H, Crystal Structure Of The Large Ribosomal Su... 76 2e-015 pdb487DM Chain M, Seven Ribosomal Proteins Fitted To A Cryo-E... 182 2e-047
Gene Protein Sequence:
MIQSESRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQATPGG AVKKGDVVKAVIVRTKSGARRADGSYIKFDENAAVIIRDDKTPRGTRIFG PVARELREGNFMKIVSLAPEVL