Secondary Evidence: Schmid,R., Bernhardt,J., Antelmann,H., Volker,A., Mach,H., Volker,U. and Hecker,M. Identification of vegetative proteins for a two-dimensional protein index of Bacillus subtilis. Microbiology 143 (Pt 3), 991-998 (1997) PubMed: 9084183.
Comment: From GenBank (gi:13878479): In Lactococcus lactis, EF-TS associates with EF-TU - GDP complex and induces the exchange of GDP to GTP. This cytoplasmic protein remains bound to the aminoacyl-tRNA-EF-TU-GTP complex up until the GTP is hydrolysed on the ribosome. It belongs to the EF-TS family.
Blast Summary:PSI-Blast Search Many strong matches in gapped BLAST to translation elongation factor Ts; residues 1-347 are 78% similar to translation elongation factor Ts of Streptococcus pyogenes (gi15675850); residues 1-347 are 80% similar to translation elongation factor Ts of Streptococcus pneumoniae (gi15904060).
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1831 (1e-156).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 12 clades of COG0264
COG name: Translation elongation factor Ts
Functional Class: J
The phylogenetic pattern of COG0264 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search ***** IPB001816 (Elongation factor Ts) with a combined E-value of 1.1e-72. IPB001816A 9-55 IPB001816B 73-89 IPB001816C 130-143 IPB001816D 180-205 IPB001816E 261-290
ProDom Summary:Protein Domain Search Residues 235-325 are 32% similar to a (ELONGATION FACTOR EF-TS BIOSYNTHESIS) protein domain (PD355203 which is seen in Q9KA64_BACHD.
Residues 8-200 are 24% similar to a (FACTOR TS ELONGATION) protein domain (PD208645 which is seen in O97235_PLAFA.
Residues 11-97 are 66% similar to a (ELONGATION FACTOR EF-TS BIOSYNTHESIS) protein domain (PD002210 which is seen in EFTS_LACLA.
Residues 140-231 are 67% similar to a (ELONGATION FACTOR EF-TS BIOSYNTHESIS) protein domain (PD106461 which is seen in EFTS_LACLA.
Residues 123-191 are 57% similar to a (FACTOR ELONGATION BIOSYNTHESIS EF-TS) protein domain (PD249321 which is seen in EFTS_BACSU.
Residues 237-329 are 72% similar to a (ELONGATION FACTOR EF-TS BIOSYNTHESIS) protein domain (PD337039 which is seen in EFTS_LACLA.
Residues 118-191 are 38% similar to a (FACTOR ELONGATION EF-TS BIOSYNTHESIS) protein domain (PD248236 which is seen in EFTS_RICPR.
Residues 98-139 are 71% similar to a (FACTOR ELONGATION EF-TS BIOSYNTHESIS) protein domain (PD375058 which is seen in EFTS_LACLA.
Residues 132-191 are 43% similar to a (FACTOR ELONGATION EF-TS BIOSYNTHESIS) protein domain (PD406595 which is seen in EFTS_CHLPN.
Residues 1-96 are 43% similar to a (FACTOR ELONGATION EF-TS BIOSYNTHESIS) protein domain (PD395995 which is seen in EFTS_PSEAE.
Paralogs:Local Blast Search SMu1846 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 4 to 44 (E-value = 5.9e-09) place SMu1846 in the UBA family which is described as UBA/TS-N domain (PF00627) Residues 57 to 325 (E-value = 7.1e-79) place SMu1846 in the EF_TS family which is described as Elongation factor TS (PF00889)
Top PDB Hits: pdb1EFUB Chain B, Elongation Factor Complex Ef-TuEF-Ts From E... 177 1e-045 pdb1AIPC Chain C, Ef-Tu Ef-Ts Complex From Thermus Thermophil... 80 3e-016
Gene Protein Sequence:
MANITAALVKELREKTGAGVMDAKKALVEVEGDMGKAIELLREKGMAKAA KKADRVAAEGLTGVYVDGNVAAIVEVNAETDFVAKNAQFVDLVNETAKVI AEGKPANNEEALALKTAAGDTLEAAYVNATATIGEKISFRRFALVEKADK QVFGAYQHNGGKIGVITVLEGENTDEALAKQLAMHVAAMNPSVLSYKELS EEFIHDELAQMNHKIEQDNESRAMVDKPALPLLKYGSKGQLTDEVVAQAE EDIKAELKAEGKPEKIWDKIIPGKMARFFLDNTKVDQQYTLLSQVYIMDD SKTVEAYMESVNGKVISFVRFEVGEGIEKAANDFENEVAATMAAALNK