Blast Summary:PSI-Blast Search Similarities in gapped BLAST to conserved hypothetical proteins and adenylyltransferases. Residues 1-209 are 83% similar to gi15901579 from S.pneumoniae. Residues 22-210 are 59% similar to gi15673081, a predicted NadD protein, from L.lactis.
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1662 (1e-104).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 11 clades of COG1057
COG name: Predicted nucleotidyltransferases
Functional Class: R
The phylogenetic pattern of COG1057 is ----Yqvcebr-ujgpol---
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 28-155 are 65% similar to a (ADENYLYLTRANSFERASE DEAMIDO-NAD NICOTINATE-NUCLEOTIDE) protein domain (PD009578 which is seen in NADD_LACLA.
Residues 164-209 are 60% similar to a (ADENYLYLTRANSFERASE DEAMIDO-NAD) protein domain (PD405848 which is seen in Q9CIY1_LACLA.
Paralogs:Local Blast Search SMu1637 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 28 to 184 (E-value = 3.6e-62) place SMu1637 in the CTP_transf_2 family which is described as Cytidylyltransferase (PF01467)
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MALELLTPFTKVELEEERKDKNRKQIGILGGNFNPVHNAHLLVADQVRQQ LGLDEVLLMPEYKPPHVDKKATIDEKHRLKMLELAIKGIEGLAIETIELK RKGVSYTYDTMKDLIEQNPDVDYYFIIGADMVDYLPKWHKIDELIQMVQF VGVQRPKYKAGTSYPVIWVDVPLMDISSSMIRDFIRKNRKPNFLLPKLVL DYIEKEGLYQ