Blast Summary:PSI-Blast Search Limited hits in gapped BLAST to conserved hypothetical proteins. Residues 3-99 are 72% similar to 15675454 from S.pyogenes and 31% similar to 15612904 from B.haldurans.
SMu1599 has no significant similarity (BLAST p-value < 1e-3) to Streptococcus agalactiae
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 3 clades of COG1518
COG name: Uncharacterized ACR
Functional Class: S
The phylogenetic pattern of COG1518 is AmtK-qv---r----------
Number of proteins in this genome belonging to this COG is 2 Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 3-99 are 31% similar to a (PROTEOME COMPLETE MJ0378 PH0173) protein domain (PD008695 which is seen in Q9KFX9_BACHD.
Paralogs:Local Blast Search SMu1599 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search No significant hits to the Pfam 11.0 database
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MAILLRRQQYRLADNDLSLAYAKRFILAKISNARKYLLRFRRDHRAKINQ QLFEEVNTELTFALEMVATARDKDTLLGIEGQAANHYFRAFNDLVLTDK