Secondary Evidence: Artsimovitch I, Svetlov V, Anthony L, Burgess RR, Landick R. RNA polymerases from Bacillus subtilis and Escherichia coli differ in recognition of regulatory signals in vitro. J Bacteriol. 2000 Nov;182(21):6027-35. PMID: 11029421
Blast Summary:PSI-Blast Search Similarities in gapped BLAST to transcription elongation factor GreA sequences. Residues 1-159 are 77% similar to 15674504 from S.pyogenes and 72% similar to 15903412 from S.pneumoniae.
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1612 (5e-65).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 10 clades of COG0782
COG name: Transcription elongation factor
Functional Class: K
The phylogenetic pattern of COG0782 is ------v-EbRHujgpolinx
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search ***** IPB001437 (Prokaryotic transcription elongation factor GreA/GreB) with a combined E-value of 2.5e-45. IPB001437A 19-68 IPB001437B 106-138
ProDom Summary:Protein Domain Search Residues 67-157 are 34% similar to a (KINASE PROTEOME NUCLEOSIDE REGULATOR) protein domain (PD083674 which is seen in Q9RV68_DEIRA.
Residues 71-140 are 67% similar to a (FACTOR TRANSCRIPTION ELONGATION COIL) protein domain (PD344060 which is seen in GREA_LACLA.
Residues 26-65 are 87% similar to a (FACTOR TRANSCRIPTION ELONGATION COIL) protein domain (PD004918 which is seen in GREA_LACLA.
Paralogs:Local Blast Search SMu1574 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 3 to 76 (E-value = 3e-24) place SMu1574 in the GreA_GreB_N family which is described as Prokaryotic transcription elongation factor, GreA/GreB, N-terminal domain (PF03449) Residues 82 to 158 (E-value = 2.2e-15) place SMu1574 in the GreA_GreB family which is described as Prokaryotic transcription elongation factor, GreA/GreB, C-terminal domain (PF01272)
Top PDB Hits: pdb|1GRJ| Grea Transcript Cleavage Factor From Escherichia Coli 118 5e-028
Gene Protein Sequence:
MSEKTYPMTLAEKEQLEQELEELKLVRRPEVIERIKIARSYGDLSENSEY EAAKDEQAFVEGQISSIETKIRYAEIVDSDAVAKNEVAIGKTVIVREVGT NDEDTYSIVGAAGADVFAGKISNESPIAQALIGKKTGDKVMIESPAGSYQ VEIVKVKKTK