Molecular function GO:0046933 hydrogen ion transporting ATP synthase activity, rotational mechanism GO:0046961 hydrogen ion transporting ATPase activity, rotational mechanism
Pathway:pathway table Folate biosynthesis Starch and sucrose metabolism
Primary Evidence: Smith,A.J., Quivey,R.G. Jr. and Faustoferri,R.C. Cloning and nucleotide sequence analysis of the Streptococcus mutans membrane-bound, proton-translocating ATPase operon Gene 183 (1-2), 87-96 (1996) PubMed: 8996091
See SMu1388 for proton-translocating ATPase, epsilon subunit. See SMu1389 for ATPase, beta subunit. See SMu1390 for ATPase, gamma subunit. See SMu1391 for ATP synthase alpha chain. See SMu1392 for ATPase, delta subunit. See SMu1393 for ATPase, b subunit. See SMu1394 for ATPase, a subunit.
Blast Summary:PSI-Blast Search Matches in gapped BLAST to ATP synthase beta subunit:residues 1-67 are 100% similar to the previously published enzyme in S.mutans (2493075|),(7436175|) and (1773260|)
Residues 1-67 are 92% similar to ATP synthase c subunit in S.bovis (2662320|).
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0857 (8e-25).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 11 clades of COG0636
COG name: FoF1-type ATP synthase c subunit/Vacuolar ATPase/archaeal ATP synthase K subunit
Functional Class: C
The phylogenetic pattern of COG0636 is AmtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search ***** IPB000454 (Eubacterial and plasma membrane ATP synthase subunit C) with a combined E-value of 1.5e-20. IPB000454 8-61
ProDom Summary:Protein Domain Search Residues 2-66 are identical to a (LIPID-BINDING C ION TRANSMEMBRANE) protein domain (PD399852 which is seen in ATPL_STRMU.
Paralogs:Local Blast Search SMu1395 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 4 to 61 (E-value = 4.7e-05) place SMu1395 in the ATP-synt_C family which is described as ATP synthase subunit C (PF00137)
Structural Feature(s):
Feature Type  
Start  
Stop
cleavable
1
30
transmembrane
44
60
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MLNLKILALGIAVLGVSLGEGILVANIAKSAARQPEMYGKLQTLMIMGVA FIEGTFFVLLASTFFVG