Blast Summary:PSI-Blast Search Matches in gapped BLAST to transposase:residues 25-107 are 60% similar to 15672035|, 565038|,and 2467221| as seen in L. lactis.
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0639 (1e-09).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search No hits to the COGs database. Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 68-107 are 62% similar to a (TRANSPOSASE PLASMID OF ELEMENT) protein domain (PD001459 which is seen in Q9CB05_LACLA.
Paralogs:Local Blast Search SMu1234 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search No significant hits to the Pfam 11.0 database
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MLKEACYKYKYYNRRRSSLRRPNLINPCFQTKGKNEIWLGDFTYIPTKAG TLYLSVSVFIDIYRRKIVGWAMGNHMQGQLVTDAFNQAYHRERPKKGLIV HTDQGSQ