Blast Summary:PSI-Blast Search Matches in gapped BLAST to conserved hypotheticals: residues 1-155 are 52% similar to gi507928 Orf170 [Salmonella typhimurium]. Residues 1-191 are 36% similar to D64006, hypothetical protein [Synechocystis sp.].
SMu1123 has no significant similarity (BLAST p-value < 1e-3) to Streptococcus agalactiae
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 9 clades of COG0518
COG name: GMP synthase - Glutamine amidotransferase domain
Functional Class: F
The phylogenetic pattern of COG0518 is AmtkYqVCebrHuj--o--n-
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 140-234 are 57% similar to a (DOMAIN OF UNKNO N) protein domain (PD279105 which is seen in Q9EUP8_STRTR.
Residues 1-124 are 60% similar to a (TRANSFERASE GLUTAMINE PROTEOME COMPLETE) protein domain (PD349562 which is seen in Q9EUP9_STRTR.
Residues 139-191 are 43% similar to a (PROTEOME COMPLETE TRANSFERASE GMP) protein domain (PD095787 which is seen in Q55488_SYNY3.
Paralogs:Local Blast Search SMu1123 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 12 to 197 (E-value = 1.1e-05) place SMu1123 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)
Structural Feature(s):
Feature Type  
Start  
Stop
transmembrane
86
102
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MRIHFILHETFEAPGAYLAWAALRGHDVSMTKVYRYEKLPKDIDDFDMLI LMGGPQSPSSTKKEFPYYDAQAEVKLIQKAAKSEKIIVGVCLGAQLMGVA YGADYLHSPKKEIGNYLISLTEAGKMDSYLSDFSDDLLVGHWHGDMPGLP DKAQVLAISQGCPRQIIKFGPKQYAFQCHLEFTPELVAALIAQEDDLDTQ SQTETYVQTAEEMQTFDYSSMNQALYSFLDRLTERK