Basic Search | Intermediate Search | Gene Image Map |  Home

Streptococcus mutans Search Results

Record: 1 of 1  
MiniMap IGR650 IGR645 IGR642 IGR643 IGR649 IGR647 IGR648 IGR641 IGR644 IGR646 mscL, - SMu0743 rpsU, - SMu0742 mutT, - SMu0738 SMu0739 glnH, - SMu0741 yabB, - SMu0737 rpoD, - SMu0746 arcT, - SMu0740 SMu0744 dnaG, - SMu0745 mscL, - SMu0743 rpsU, - SMu0742 mutT, - SMu0738 SMu0739 glnH, - SMu0741 yabB, - SMu0737 rpoD, - SMu0746 arcT, - SMu0740 SMu0744 dnaG, - SMu0745 mscL, - SMu0743 rpsU, - SMu0742 mutT, - SMu0738 SMu0739 glnH, - SMu0741 yabB, - SMu0737 rpoD, - SMu0746 arcT, - SMu0740 SMu0744 dnaG, - SMu0745


LANL Gene ID: SMu0742

GenBank Locus Tag: SMU.818

DNA Molecule Name:
1  

GenBank ID:
24379273

Gene Name:
rpsU  

Definition:
30S ribosomal protein S21

Cellular Location:
Periplasm, Extracellular [Evidence]

Gene Start:
763222

Gene Stop:
763398

Gene Length:
177

Molecular Weight*:
6955

pI*:
11.90

Net Charge*:
14.98

EC:
 

Functional Class:
Protein synthesis; Ribosomal proteins: synthesis and modification  

Gene Ontology:
Biological process
  GO:0006412    translation

Cellular component
  GO:0005622    intracellular
  GO:0005840    ribosome

Molecular function
  GO:0003735    structural constituent of ribosome


Pathway: pathway table

Secondary Evidence:
Higo,K., Otaka,E. and Osawa,S.
Purification and characterization of 30S ribosomal proteins from
Bacillus subtilis: correlation to Escherichia coli 30S proteins
Mol. Gen. Genet. 185 (2), 239-244 (1982)
PubMed: 6806564

Vandekerckhove,J., Rombauts,W., Peeters,B. and Wittmann-Liebold,B.
Determination of the complete amino acid sequence of protein S21
from Escherichia coli ribosomes
Hoppe-Seyler's Z. Physiol. Chem. 356 (12), 1955-1976 (1975)
PubMed: 765257


Comment:
For other 'rps' genes see SMu0137 (rpsO); SMu0153 (rpsI);SMu1937 (rpsD); SMu0788 (rpsP);SMu1841 (rps10); SMu1838 (rps19);SMu0322 (rpsL); SMu0323 (rpsG); SMu1030 (rpsT); SMu1097 (rpsA); SMu1692 (rpsR) and SMu1694 (rpsF).



View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to 30S ribosomal protein S21: residues 1-43 are 100% similar to the protein in S.pyogenes (gi15674824)and are 95% similar to the protein from S.pneumoniae (gi15903314).






The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1429 (2e-19).


Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|15674824|ref|NP_268998.1|  30S ribosomal protein S21 [Str...    63   4e-09
 gi|50913960|ref|YP_059932.1|  SSU ribosomal protein S21P [St...    63   4e-09
 gi|71910410|ref|YP_281960.1|  SSU ribosomal protein S21P [St...    63   4e-09
 gi|81177349|ref|ZP_00876183.1|  Ribosomal protein S21 [Strep...    62   9e-09
 gi|29376911|ref|NP_816065.1|  ribosomal protein S21 [Enteroc...    62   1e-08
 gi|69245353|ref|ZP_00603397.1|  Ribosomal protein S21 [Enter...    61   2e-08
 gi|15901268|ref|NP_345872.1|  ribosomal protein S21 [Strepto...    61   2e-08
 gi|15903314|ref|NP_358864.1|  30S Ribosomal protein S21 [Str...    61   2e-08
 gi|146319087|ref|YP_001198799.1|  30S Ribosomal protein S21 ...    61   2e-08
 gi|15672222|ref|NP_266396.1|  30S ribosomal protein S21 [Lac...    59   8e-08


InterPro Summary:  InterProScan

InterPro
IPR001911
Family
Ribosomal protein S21
PD005521 [16-43]T 5e-09 PD005521 RS21_STRPY_Q9A0H1; RS21_STRPY_Q9A0H1;
PR00976 [5-13]T 1.4e-15 PR00976 RIBOSOMALS21[13-22]T 1.4e-15 PR00976 RIBOSOMALS21[25-35]T 1.4e-15 PR00976 RIBOSOMALS21[37-47]T 1.4e-15 PR00976 RIBOSOMALS21 RIBOSOMALS21
PF01165 [2-55]T 1.1e-30 PF01165 Ribosomal_S21 Ribosomal_S21
TIGR00030 [2-57]T 1.5e-22 TIGR00030 S21p: ribosomal protein S21 S21p: ribosomal protein S21
PS01181 [13-25]T 8e-5 PS01181 RIBOSOMAL_S21 RIBOSOMAL_S21


COGS Summary:  COGS Search
BeTs to 8 clades of COG0828
COG name: Ribosomal protein S21
Functional Class: J
The phylogenetic pattern of COG0828 is -----q-ceb-huj--olinx
Number of proteins in this genome belonging to this COG is 1
Blocks Summary:  Blocks Search
***** IPB001911 (Ribosomal protein S21) with a combined E-value of 1.8e-32.
    IPB001911    6-48


 ProDom Summary:  Protein Domain Search
Residues 2-43 are 90% similar to a (RIBOSOMAL 30S DNA GENOMIC) protein domain (PD005521 which is seen in RS21_LISMO.


Paralogs:  Local Blast Search
SMu0742 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 55 (E-value = 1e-30) place SMu0742 in the Ribosomal_S21 family which is described as Ribosomal protein S21 (PF01165)

 Top PDB Hits:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSE
AARKRKKF

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAAAGACAGTAGTGCGCAAAAATGAATCACTTGACGATGCTCTTCG
TCGTTTCAAACGTTCTGTAACTAAAGCTGGTACACTTCAAGAATCACGCA
AACGTGAATTCTACGAAAAACCTTCTGTAAAGCGCAAACGTAAATCAGAA
GCAGCTCGCAAACGTAAAAAATTCTAA

Los Alamos National Laboratory • Est 1943

Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy