Blast Summary:PSI-Blast Search Several matches in gapped BLAST to transcription regulator: residues 1-157 are 79% similar to the protein in S.pyogenes (15674682|). Residues 1-157 are 70% similar to the protein from Lactococcus lactis subsp.lactis (15672298|).
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0753 (2e-67).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search No hits to the COGs database. Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 28-139 are 74% similar to a (PROTEOME COMPLETE TRANSCRIPTION) protein domain (PD009524 which is seen in Q9CIP0_LACLA.
Paralogs:Local Blast Search SMu0642 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 18 to 155 (E-value = 5.8e-51) place SMu0642 in the YbaK family which is described as YbaK / prolyl-tRNA synthetases associated domain (PF04073)
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MSKKKKLKKTLVEQILDKAKIKHDSLALNALEGKLPEDIQKEDIFKTLAL TGDKTGPLIGIIPITEHLSEKKLAKVSANKKVTMIPQKELQKITGYVHGA NNPVGIRQKHHFPIFIDSIALEKGQIIVSAGEIGRSIRINSQVLADFVGA QFADLKE