Basic Search | Intermediate Search | Gene Image Map |  Home

Streptococcus mutans Search Results

Record: 1 of 1  
MiniMap IGR559 IGR558 IGR553 IGR549 IGR555 IGR556 IGR552 IGR551 IGR550 IGR554 IGR557 fer, - SMu0634 SMu0641 gpmB, - SMu0640 SMu0643 rpmI, - SMu0638 rplT, - SMu0639 SMu0635 thmA, - SMu0633 infC, - SMu0637 SMu0631 cmk, - SMu0636 pepT, - SMu0632 atlA,aml, - SMu0630 fer, - SMu0634 SMu0641 gpmB, - SMu0640 SMu0643 rpmI, - SMu0638 rplT, - SMu0639 SMu0635 thmA, - SMu0633 infC, - SMu0637 SMu0631 cmk, - SMu0636 pepT, - SMu0632 atlA,aml, - SMu0630 fer, - SMu0634 gpmB, - SMu0640 ydbF, - SMu0642 SMu0643 SMu0641 ydbF, - SMu0642 rplT, - SMu0639 SMu0635 thmA, - SMu0633 infC, - SMu0637 SMu0631 cmk, - SMu0636 pepT, - SMu0632 atlA,aml, - SMu0630 rpmI, - SMu0638


LANL Gene ID: SMu0634

GenBank Locus Tag: SMU.694c

DNA Molecule Name:
1  

GenBank ID:
24379165

Gene Name:
fer  

Definition:
ferredoxin

Cellular Location:
Periplasm, Cytoplasm [Evidence]

Gene Start:
659245

Gene Stop:
659051

Gene Length:
195

Molecular Weight*:
6948

pI*:
4.90

Net Charge*:
-1.21

EC:
 

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Gene Ontology:
Biological process
  GO:0006118    electron transport

Molecular function
  GO:0009055    electron carrier activity
  GO:0051536    iron-sulfur cluster binding


Pathway: pathway table

Secondary Evidence:
Elliott,J.I., Yang,S.S., Ljungdahl,L.G., Travis,J. and Reilly,C.F.
Complete amino acid sequence of the 4Fe-4S, thermostable ferredoxin from Clostridium thermoaceticum
Biochemistry 21 (14), 3294-3298 (1982)
PubMed: 7115670

Hase,T., Ohmiya,N., Matsubara,H., Mullinger,R.N., Rao,K.K. and
Hall,D.O.
Amino acid sequence of a four-iron-four-sulphur ferredoxin isolated from Bacillus stearothermophilus
Biochem. J. 159 (1), 55-63 (1976)
PubMed: 999643

Fukuyama,K., Nagahara,Y., Tsukihara,T., Katsube,Y., Hase,T. and
Matsubara,H.
Tertiary structure of Bacillus thermoproteolyticus [4Fe-4S]
ferredoxin. Evolutionary implications for bacterial ferredoxins
Journal of molecular biology. 199 (1), 183-193 (1988)
PubMed: 3351918

Fukuyama,K., Matsubara,H., Tsukihara,T. and Katsube,Y.
Structure of [4Fe-4S] ferredoxin from Bacillus thermoproteolyticus
refined at 2.3 A resolution. Structural comparisons of bacterial
ferredoxins
Journal of molecular biology. 210 (2), 383-398 (1989)
PubMed: 2600971




Comment:
Ferredoxin are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions [gi:119994].





View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to ferredoxin: residues 1-63 are 64% similar to the protein in S.pyogenes (15674843|). Residues 1-61 are 59% similar to the protein from S.pneumoniae (15901445|).







The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1387 (2e-20).


Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|24379165|ref|NP_721120.1|  putative ferredoxin [4Fe-4S] [...   117   2e-25
 gi|81096909|ref|ZP_00875234.1|  ferredoxin [Streptococcus su...    84   2e-15
 gi|77408641|ref|ZP_00785375.1|  ferredoxin, 4Fe-4S-related p...    84   3e-15
 gi|146318927|ref|YP_001198639.1|  Ferredoxin [Streptococcus ...    84   3e-15
 gi|77415054|ref|ZP_00791119.1|  ferredoxin, 4Fe-4S-related p...    82   9e-15
 gi|116627863|ref|YP_820482.1|  Ferredoxin [Streptococcus the...    82   1e-14
 gi|55821148|ref|YP_139590.1|  ferredoxin [Streptococcus ther...    81   2e-14
 gi|15903501|ref|NP_359051.1|  Ferredoxin [Streptococcus pneu...    80   4e-14
 gi|125718314|ref|YP_001035447.1|  Ferredoxin, putative [Stre...    79   9e-14
 gi|94990180|ref|YP_598280.1|  Ferredoxin [Streptococcus pyog...    79   1e-13


InterPro Summary:  InterProScan

InterPro
IPR001450
Domain
4Fe-4S ferredoxin, iron-sulfur binding
PR00353 [3-14]T 0.049 PR00353 4FE4SFRDOXIN[51-62]T 0.049 PR00353 4FE4SFRDOXIN 4FE4SFRDOXIN
noIPR
unintegrated
unintegrated
G3DSA:3.30.70.20 [1-61]T 2.29999935665378E-5 G3DSA:3.30.70.20 G3DSA:3.30.70.20 G3DSA:3.30.70.20
SSF54862 [1-63]T 1.2E-4 SSF54862 SSF54862 SSF54862


COGS Summary:  COGS Search
BeTs to 3 clades of COG1141
COG name: Ferredoxin 1
Functional Class: C
The phylogenetic pattern of COG1141 is a-t---v--bR----------
Number of proteins in this genome belonging to this COG is 1
Blocks Summary:  Blocks Search
***** PR00353 (4Fe-4S ferredoxin signature) with a combined E-value of 4.1e-06.
    PR00353A    3-14
    PR00353B    51-62


 ProDom Summary:  Protein Domain Search
Residues 6-61 are 56% similar to a (I IRON-SULFUR PHOTOSYSTEM FERREDOXIN) protein domain (PD009020 which is seen in Q9CEX9_LACLA.


Paralogs:  Local Blast Search
SMu0634 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

 Top PDB Hits:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKVAIIPEKCIACGLCQTYSGVFDYNDDGIVIFTDSKEKIKTVADDPNIL
MAVKNCPTKALTLP

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTAGCAATTATCCCAGAAAAATGTATTGCCTGTGGGCTTTGTCA
AACCTATTCAGGCGTTTTTGATTATAATGATGATGGTATTGTCATTTTTA
CAGACAGCAAGGAAAAGATTAAAACAGTTGCTGATGATCCAAATATCCTT
ATGGCTGTTAAAAATTGTCCAACAAAAGCTCTTACATTACCGTAA

Los Alamos National Laboratory • Est 1943

Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy