Basic Search | Intermediate Search | Gene Image Map |  Home

Streptococcus mutans Search Results

Record: 1 of 1  
MiniMap IGR497 IGR496 IGR493 IGR495 IGR492 IGR498 IGR491 IGR494 queA, - SMu0576 SMu0574 sod,sodA, - SMu0571 SMu0569 SMu0573 holA, - SMu0570 SMu0572 tesA, - SMu0575 comEC,celB, - SMu0568 queA, - SMu0576 SMu0574 sod,sodA, - SMu0571 SMu0569 SMu0573 holA, - SMu0570 SMu0572 tesA, - SMu0575 comEC,celB, - SMu0568 queA, - SMu0576 sod,sodA, - SMu0571 SMu0569 SMu0573 holA, - SMu0570 SMu0572 tesA, - SMu0575 comEC,celB, - SMu0568 comEA,celA, - SMu0567 comEA,celA, - SMu0567 SMu0574


LANL Gene ID: SMu0571

GenBank Locus Tag: SMU.629

DNA Molecule Name:
1  

GenBank ID:
24379102

Gene Name:
sod  sodA  

Definition:
superoxide dismutase

Cellular Location:
Extracellular, Cytoplasm [Evidence]

Gene Start:
588268

Gene Stop:
588879

Gene Length:
612

Molecular Weight*:
22610

pI*:
4.90

Net Charge*:
-10.07

EC:
1.15.1.1  

Functional Class:
Cellular processes; Detoxification  

Gene Ontology:
Biological process
  GO:0006801    superoxide metabolic process

Molecular function
  GO:0004784    superoxide dismutase activity
  GO:0046872    metal ion binding


Pathway: pathway table

Primary Evidence:
Abranches J, Lemos JA, Burne RA.,
Osmotic stress responses of Streptococcus mutans UA159.
FEMS Microbiol Lett. 2006 Feb;255(2):240-6.
PMID: 16448501

Nakayama,K.
Nucleotide sequence of Streptococcus mutans superoxide dismutase
gene and isolation of insertion mutants
J. Bacteriol. 174 (15), 4928-4934 (1992)
PubMed: 1321118

Martin,M.E., Byers,B.R., Olson,M.O., Salin,M.L., Arceneaux,J.E. and Tolbert,C.
A Streptococcus mutans superoxide dismutase that is active with
either manganese or iron as a cofactor
J. Biol. Chem. 261 (20), 9361-9367 (1986)
PubMed: 3722201

Poyart,C., Quesne,G., Coulon,S., Berche,P. and Trieu-Cuot,P.
Identification of streptococci to species level by sequencing the
gene encoding the manganese-dependent superoxide dismutase
J. Clin. Microbiol. 36 (1), 41-47 (1998)
PubMed: 9431917

Secondary Evidence:
Gerlach,D., Reichardt,W. and Vettermann,S.
Extracellular superoxide dismutase from Streptococcus pyogenes type 12 strain is manganese-dependent
FEMS Microbiol. Lett. 160 (2), 217-224 (1998)
PubMed: 9532741

Gibson,C.M. and Caparon,M.G.
Insertional inactivation of Streptococcus pyogenes sod suggests
that prtF is regulated in response to a superoxide signal
J. Bacteriol. 178 (15), 4688-4695 (1996)
PubMed: 8755901

Poyart,C., Berche,P. and Trieu-Cuot,P.
Characterization of superoxide dismutase genes from gram-positive
bacteria by polymerase chain reaction using degenerate primers
FEMS Microbiol. Lett. 131 (1), 41-45 (1995)
PubMed: 7557308

Inaoka,T., Matsumura,Y. and Tsuchido,T.
Molecular cloning and nucleotide sequence of the superoxide
dismutase gene and characterization of its product from Bacillus
subtilis
J. Bacteriol. 180 (14), 3697-3703 (1998)
PubMed: 9658017

Sanders,J.W., Leenhouts,K.J., Haandrikman,A.J., Venema,G. and
Kok,J.
Stress response in Lactococcus lactis: cloning, expression
analysis, and mutation of the lactococcal superoxide dismutase gene
J. Bacteriol. 177 (18), 5254-5260 (1995)
PubMed: 7665513

Bowler,C., Van Kaer,L., Van Camp,W., Van Montagu,M., Inze,D. and
Dhaese,P.
Characterization of the Bacillus stearothermophilus manganese
superoxide dismutase gene and its ability to complement copper/zinc superoxide dismutase deficiency in Saccharomyces cerevisiae
J. Bacteriol. 172 (3), 1539-1546 (1990)
PubMed: 2407726







Comment:
This enzyme destroys radicals which are normally produced within the cells and are toxic to biological systems [gi:2507403].





View in HOMD Genome Viewer

Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to superoxide dismutase:residues 1-203 are 93% similar to the previously published enzyme in S.mutans (2507403|).

Residues 1-200 are 78% similar to the enzyme from S.pyogenes (15675326|) and are 76% similar to the enzyme from S.agalactiae (2765187|).








The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0788 (1e-90).


Top Blast Hits:  Updated monthly
Click here to view the entire PsiBlast results.
 gi|24379102|ref|NP_721057.1|  putative manganese-type supero...   378   e-103
 gi|55822689|ref|YP_141130.1|  superoxide dismutase (Mn) [Str...   347   2e-94
 gi|55820786|ref|YP_139228.1|  superoxide dismutase (Mn) [Str...   347   2e-94
 gi|116627592|ref|YP_820211.1|  Superoxide dismutase [Strepto...   344   1e-93
 gi|146321397|ref|YP_001201108.1|  manganese-dependent supero...   340   3e-92
 gi|50914466|ref|YP_060438.1|  Superoxide dismutase [Streptoc...   335   7e-91
 gi|21910607|ref|NP_664875.1|  superoxide dismutase [Streptoc...   335   7e-91
 gi|94990725|ref|YP_598825.1|  Superoxide dismutase [Streptoc...   335   1e-90
 gi|71903801|ref|YP_280604.1|  superoxide dismutase [Streptoc...   335   1e-90
 gi|15675326|ref|NP_269500.1|  superoxide dismutase (Fe/Mn) [...   335   1e-90


InterPro Summary:  InterProScan

InterPro
IPR001189
Family
Manganese and iron superoxide dismutase
PD000475 [96-203]T 0.0 PD000475 SODismutase SODismutase
PR01703 [6-17]T 5.0E-27 PR01703 MNSODISMTASE[27-40]T 5.0E-27 PR01703 MNSODISMTASE[72-85]T 5.0E-27 PR01703 MNSODISMTASE[124-132]T 5.0E-27 PR01703 MNSODISMTASE[161-173]T 5.0E-27 PR01703 MNSODISMTASE MNSODISMTASE
PTHR11404 [1-201]T 4.2000346049276595E-105 PTHR11404 SODismutase SODismutase
PF00081 [2-89]T 5.0000090991531504E-39 PF00081 Sod_Fe_N Sod_Fe_N
PF02777 [96-197]T 1.30000495407324E-67 PF02777 Sod_Fe_C Sod_Fe_C
PS00088 [163-170]T 8.0E-5 PS00088 SOD_MN SOD_MN
SSF46609 [1-90]T 9.200000000000001E-36 SSF46609 SODismutase SODismutase
SSF54719 [90-200]T 3.1000000000000007E-43 SSF54719 SODismutase SODismutase
noIPR
unintegrated
unintegrated
PTHR11404:SF9 [1-201]T 4.2000346049276595E-105 PTHR11404:SF9 PTHR11404:SF9 PTHR11404:SF9


COGS Summary:  COGS Search
BeTs to 11 clades of COG0605
COG name: Superoxide dismutase
Functional Class: P
The phylogenetic pattern of COG0605 is --t-Yq-cEBrhuj--o-inx
Number of proteins in this genome belonging to this COG is 1
Blocks Summary:  Blocks Search
***** IPB001189 (Manganese and iron superoxide dismutase (SODM)) with a combined E-value of 2.1e-92.
    IPB001189A    5-40
    IPB001189B    74-90
    IPB001189C    95-132
    IPB001189D    158-190


 ProDom Summary:  Protein Domain Search
Residues 5-200 are 92% similar to a (DISMUTASE SUPEROXIDE OXIDOREDUCTASE MANGANESE MN IRON) protein domain (PD000475 which is seen in SODM_STRMU.


Paralogs:  Local Blast Search
SMu0571 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 89 (E-value = 3.2e-42) place SMu0571 in the Sod_Fe_N family which is described as Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081)
Residues 96 to 197 (E-value = 5e-61) place SMu0571 in the Sod_Fe_C family which is described as Iron/manganese superoxide dismutases, C-terminal domain (PF02777)

 Top PDB Hits:
pdb|1MNG|A Chain A, Manganese Superoxide Dismutase (E.C.1.15.1.... 217 9e-058
pdb|1D5N|A Chain A, Crystal Structure Of E. Coli Mnsod At 100k ... 199 2e-052
pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutas... 166 2e-042

Gene Protein Sequence:
MAILLPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPEIG
ENLEVLLADVEQIPADIRQSLINNGGGHLNHALFWELLSPEKTKVTAEVA
AAINEAFGSFDDFKAAFTAAATTRFGSGWAWLVVDKEGKLEVTSTANQDT
PISQGLKPILALDVWEHAYYLNYRNVRPNYIKAFFEVINWNTVARLYAEA
LTK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTATTCTTTTACCAGATCTTCCATATGCTTATGACGCACTTGAACC
ATATATTGATGCTGAAACGATGACCCTTCATCATGATAAGCATCATGCAA
CTTATGTCGCAAACGCTAATGCGGCTCTTGAAAAACATCCAGAAATCGGA
GAAAATTTGGAAGTGCTTTTGGCTGATGTGGAACAAATTCCAGCGGATAT
TCGTCAGTCTTTGATTAATAATGGTGGCGGTCATCTTAATCACGCTCTTT
TCTGGGAACTCTTGTCACCAGAAAAGACAAAAGTTACTGCGGAAGTAGCC
GCAGCAATTAATGAAGCTTTTGGCTCATTTGATGATTTTAAAGCAGCTTT
TACAGCTGCCGCAACGACGCGTTTTGGCTCAGGTTGGGCTTGGTTAGTAG
TTGATAAAGAAGGAAAACTTGAAGTGACCTCAACAGCTAATCAAGATACT
CCAATTTCACAGGGCTTGAAACCAATTCTAGCACTTGATGTCTGGGAACA
CGCTTATTATCTCAATTATCGTAATGTTCGTCCAAACTATATCAAAGCCT
TCTTTGAAGTTATCAATTGGAACACTGTTGCTCGTCTTTATGCCGAAGCT
CTCACTAAATAA

Los Alamos National Laboratory • Est 1943

Operated by Los Alamos National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
Inside | © Copyright 2006 LANS LLC All rights reserved | Disclaimer/Privacy