Blast Summary:PSI-Blast Search Matches in gapped BLAST to ribosomal proteins, some said to be of the L7a family. Residues 12-100 are 73% similar to >gi15900467 from S.pneumoniae and are 76% similar to gi15675572 from S.pyogenes.
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG0380 (4e-33).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search BeTs to 3 clades of COG1358
COG name: Ribosomal protein HS6-type (S12/L30/L7a)
Functional Class: J
The phylogenetic pattern of COG1358 is amtkY-v--B-----------
Number of proteins in this genome belonging to this COG is 1 Blocks Summary:Blocks Search No significant hits to the Blocks database.
Paralogs:Local Blast Search SMu0381 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 5 to 96 (E-value = 2.5e-15) place SMu0381 in the Ribosomal_L7Ae family which is described as Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248)
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MNNSKKLSNLLGLAQRAGRVISGEELVVKAIQTGQAQLIFLAKDAGSNLT KKVTDKSNYYNIEVSTVFSALELSIAIGRNRKVLAIVDTGFSKKMRTFME