Blast Summary:PSI-Blast Search Several matches in gapped BLAST to conserved hypotheetical proteins. Residues 5-92 are 84% similar to 15902261 of S.pneumoniae.
The best hit to the Streptococcus agalactiae 2603 V/R genome is to SAG1566 (3e-06).
Top Blast Hits:Updated monthly
Click here to view the entire PsiBlast results.
COGS Summary:COGS Search No hits to the COGs database. Blocks Summary:Blocks Search No significant hits to the Blocks database.
ProDom Summary:Protein Domain Search Residues 6-92 are 50% similar to a (PROTEOME COMPLETE REPRESSOR PHOSPHOSERINE) protein domain (PD029187 which is seen in Q9CGZ6_LACLA.
Paralogs:Local Blast Search SMu0065 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.
Pfam Summary:Pfam Search Residues 7 to 78 (E-value = 8e-07) place SMu0065 in the ACT family which is described as ACT domain (PF01842)
Top PDB Hits: No significant hits to the NCBI PDB database.
Gene Protein Sequence:
MEANMKAIITVVGKDRTGIVAGVSTKIAELGLNIDDITQTVLDEYFTMMA VVSSQESQDFAQLRKEFEAFGETLNVKINIQSSAIFDAMHNL