Upload a Sequence from a local File
OR Paste Sequence into this box (see format options)
Program to run: Reformat Motifs Isoelectric HelicalWheel mapPeptide pepPlot PlotStructure BackTranslate (Best) BackTranslate (Ambiguous) Show Program Options
Include reference information about matched patterns Yes No
Output report format GFF PIR SwissProt EMBOSS list file DbMotif EMBOSS diffseq tab-delimited text EMBOSS FeatTable EMBOSS Motif EMBOSS Regions EMBOSS SeqTable SRS simple SRS EMBOSS Table EMBOSS tagseq
Include the following elements in the output:
Histogram of properties Hydropathy Histogram & Hydropathy
>NRBSN MMKMEGIALKKRLSWISVCLLVLVSAAGMLFSTAAKTETSSHKAHTEAQVINTFDGVADY LQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWRE ADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR